Dfci orf
Dfci orf
WORFDB Website
Example of the result-page for an ORF that could not be cloned in ORFeome version 1 but ... 2008 WORFDB.dfci.harvard.edu All rights reserved. (more...)
Human Orfeome 3.1
for requesting any ORF clones Guest Book for comments and suggestions ... is made possible through support from the High-Tech Fund of the Dana-Farber Cancer Institute, the ... (more...)
The Orfeome Collaboration
DFCI-RIKEN.orf LIB_ID: 2464 ORGANISM: human ORGAN: unspecified HOST: DH5alpha T1-resistant VECTOR: pDONR223 V_TYPE: plasmid RE_5': attL1.1 RE_3': attL2.1 (more...)
Tags:
Orfeome
Collaboration
Geneservice - Product - cdna - C. elegans ORFeome version 1.1
In a collaborative effort based at the Dana-Farber Cancer Institute and ... integrates with other mapping data (http://worfdb.dfci.harvard.edu/). There is also a "C elegans ORF ... (more...)
DFCI - ORF Report
5' end: 1: 3' end: 1077: orf: (357 aa) ptppppxpivishaaspennhhhpsktkdkakmgsryevevtvgaardlknvnwrngdlk pyavlwidagarcstrvdldngenptwddkvvvplppasrlqdavlyldivhanapegvk ... (more...)
WORFDB Website
for requesting any ORF clones ; Tech Support. Please email us with your questions or comments. ... 2008 WORFDB.dfci.harvard.edu All rights reserved. (more...)
DFCI - ORF Report
The email option allows the user to be notified by email when the blast search is completed. The email will contain a link to the results. Use this option when running a lengthy ... (more...)
DFCI - ORF Report
5' end: 1175: 3' end: 349: orf: (275 aa) mqefmilpigapsfkeamkmgvevyhhlkavikkkygqdatnvgdeggfapniqenkegl ellktaiakagytkevvigmdvaasefygtdktydlnfkeenndgsekisgdalknlyks ... (more...)
DFCI - ORF Report
5' end: 191: 3' end: 728: orf: (178 aa) mvefhlstqlrhrpglgdmamekthltpntkpqatsdntkdtnliixhtstqptlffkps naippissaitsyssyimcllatgavntgaaittlaaalvlgcwnfhhngrniallglyd ... (more...)
Human ORFeome V5.1
Introduction; ORF Search; Plate Search; Sequence Search; GO Slim Search; Tools & Data ... is made possible through support from the High-Tech Fund of the Dana-Farber Cancer Institute, the ... (more...)
